DR. DIANE M. KEPNER M.D. NPI 1487626461

NPI Information

  • NPI: 1487626461
  • Provider Name: DR. DIANE M. KEPNER, M.D.
  • Classification: Family Medicine - 207Q00000X
  • Entity Type: Individual
  • PECOS Registration: Yes
  • Address: 80 WYNTRE BROOKE DR
    YORK, PA
    ZIP 17403
  • Phone: (717) 741-9462

Map and Directions

Get Directions

NPI Details

DR. Diane M. Kepner, M.D. is a family medicine in York, PA with 29 years of experience. The provider is family Medicine is the medical specialty which is concerned with the total health care of the individual and the family. It is the specialty in breadth which integrates the biological, clinical, and behavioral sciences. The scope of family medicine is not limited by age, sex, organ system, or disease entity. DR. Diane M. Kepner, M.D. NPI is 1487626461. The provider is registered as an individual entity type.

The NPPES NPI record indicates the provider is a female.

The provider's business location address is:

80 WYNTRE BROOKE DR
YORK, PA
ZIP 17403-535
Phone: (717) 741-9462
Fax: (717) 741-4399

The NPI 1487626461 is registered in the Medicare Provider, Enrollment, Chain and Ownership System (PECOS). The provider is legally eligible to order and refer Part B (Clinical Laboratory and Imaging), Durable Medical Equipment, Part A Home Health Agency (HHA), Power Mobility Devices.

The following top HCPCS codes were publicly reported for this provider under the Medicare program for the year 2016. The reported codes are based on the top codes for each available Medicare specialty, excluding evaluation and management codes.

  • Established patient office or other outpatient visit, 30-39 minutes (HCPCS:99214)
  • Established patient office or other outpatient visit, 20-29 minutes (HCPCS:99213)
  • Insertion of needle into vein for collection of blood sample (HCPCS:36415)
  • Blood test, comprehensive group of blood chemicals (HCPCS:80053)
  • Complete blood cell count (red cells, white blood cell, platelets), automated test and automated differential white blood cell count (HCPCS:85025)
  • Annual wellness visit, includes a personalized prevention plan of service (pps), subsequent visit (HCPCS:G0439)
  • Routine electrocardiogram (ecg) using at least 12 leads with interpretation and report (HCPCS:93000)
  • Blood test, thyroid stimulating hormone (tsh) (HCPCS:84443)
  • Thyroid hormone, t3 measurement, free (HCPCS:84481)
  • Thyroxine (thyroid chemical), free (HCPCS:84439)
  • Blood test, lipids (cholesterol and triglycerides) (HCPCS:80061)
  • Hemoglobin a1c level (HCPCS:83036)
  • Annual, face-to-face intensive behavioral therapy for cardiovascular disease, individual, 15 minutes (HCPCS:G0446)
  • Annual depression screening, 15 minutes (HCPCS:G0444)
  • Vitamin d-3 level (HCPCS:82306)
  • Creatinine level to test for kidney function or muscle injury (HCPCS:82570)
  • Urine microalbumin (protein) level (HCPCS:82043)
  • Automated urinalysis test (HCPCS:81003)
  • Manual urinalysis test with examination using microscope, automated (HCPCS:81001)
  • Uric acid level, blood (HCPCS:84550)
  • Administration of influenza virus vaccine (HCPCS:G0008)
  • Influenza vaccine split virus, preservative free (HCPCS:90662)
  • Bacterial colony count, urine (HCPCS:87086)
  • Psa (prostate specific antigen) measurement, total (HCPCS:84153)
  • Iron level (HCPCS:83540)
  • Iron binding capacity (HCPCS:83550)
  • Glutamyltransferase (liver enzyme) level (HCPCS:82977)
  • Established patient office or other outpatient visit, 40-54 minutes (HCPCS:99215)
  • Transitional care management services for problem of high complexity (HCPCS:99496)
  • Ferritin (blood protein) level (HCPCS:82728)
  • Evaluation of antimicrobial drug (antibiotic, antifungal, antiviral) (HCPCS:87184)
  • Administration of pneumococcal vaccine (HCPCS:G0009)
  • Magnesium level (HCPCS:83735)
  • Initial preventive physical examination; face-to-face visit, services limited to new beneficiary during the first 12 months of medicare enrollment (HCPCS:G0402)
  • New patient office or other outpatient visit, 45-59 minutes (HCPCS:99204)

The enumeration date for this NPI number is 2/3/2006 and was last updated on 12/9/2010.

Taxonomy Codes

The NPI record includes the healthcare provider taxonomy classification, state license number and state of licensure. The following information regarding the scope of practice of this provider is available:

No. Taxonomy Code Taxonomy Clasification Taxonomy Specialization License Number License State Primary
1207Q00000XFamily MedicineMD069472LPENNSYLVANIAYes

Other Identifiers

The following information regarding additional identifiers associated to this NPI record includes the other identifier number, identifier type, identifier state and issuer.

No. Other Provider Identifier Other Provider Identifier Type Other Provider Identifier State Other Provider Identifier Issuer
102377500OTHERPENNSYLVANIACAPITAL BLUE CROSS
2606644OTHERPENNSYLVANIAHIGHMARK BLUE SHIELD
3136324OTHERPENNSYLVANIAHEALTH AMERICA
41520948OTHERPENNSYLVANIAGATEWAY HEALTH PLAN
5H14036MEDICARE UPINPENNSYLVANIA
6037262PL6MEDICARE ID-TYPE UNSPECIFIEDPENNSYLVANIAMEDICARE
70018746480001MEDICAIDPENNSYLVANIA

What is NPI?

NPI stands for National Provider Identifier. The NPI is a 10-digit identification number that is completely unique. The NPI number by itself does not contain any identifiable information such as a provider’s speciality or location. The NPI is assigned to individuals or organizacions for their lifespan and it is independent of key provider information type updates like a change of practices, location or speciality.

This page was last updated on: 11/21/2025

NPI Synchronization or Removal

All materials and services on this site are provided on an "as is" and "as available" basis without warranty of any kind. The NPI record is maintained by the National Plan & Provider Enumeration System (NPPES) and anyone may request this information and other NPPES health care provider data from HHS under The Freedom of Information Act (FOIA), Title 5 of the United States Code, section 552. To update the NPI records please contact the NPPES.